May play a role in the transport of fatty acids. Binds fatty acids and fatty acyl-CoAs including palmitic acid, oleic acid, cis-parinaric acid and palmitoyl-CoA (in vitro).

129 amino acids

MSLKVDGFTSSIIFDVIRDGLNDPSQAKQKAESIKKANAIIVFNLKNKAGKTESWYLDLKNDGDVGKGNKSPKGDADIQLTLSDDHFQQLVEGKANAQRLFMTGKLKVKGNVMKAAAIEGILKNAQNNL

14 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make SCP2 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here