May play a role in sequestering potentially toxic fatty acids and their peroxidation products, or it may be involved in the maintenance of the impermeable lipid layer of the eggshell.

Belongs to the calycin superfamily. Fatty-acid binding protein (FABP) family.

161 amino acids

MSSKFLILLAFCGATLVAAEQLPEKFYGTFDLDHSENFDEYLTAKGYGWFTRKLVTFATFKKVFAKNANKNLFDYSNLTSKKDVFYKNVQIGSKFEGEGLDNTKHEVTFTLKDGHLFEHHKPLEEGESKEETYEYYFDGDFLIQKMSFNNIEGRRFYKRLP

18.8 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make lbp-2 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here