Intracellular carrier for long-chain fatty acids and related active lipids, such as the endocannabinoid, that regulates the metabolism and actions of the ligands they bind. In addition to the cytosolic transport, selectively delivers specific fatty acids from the cytosol to the nucleus, wherein they activate nuclear receptors (By similarity). Delivers retinoic acid to the nuclear receptor peroxisome proliferator-activated receptor delta; which promotes proliferation and survival. May also serve as a synaptic carrier of endocannabinoid at central synapses and thus controls retrograde endocannabinoid signaling. Modulates inflammation by regulating PTGES induction via NF-kappa-B activation, and prostaglandin E2 (PGE2) biosynthesis during inflammation (By similarity). Has the highest binding affinity for docosahexaenoic acid (DHA) and decreasing relative affinity for eicosapentaenoic acid (EPA), alpha-linolenic acid (ALA), oleic acid, palmitic acid, linoleic acid and stearic acid, respectively (PubMed:26206084).

Belongs to the calycin superfamily. Fatty-acid binding protein (FABP) family.

134 amino acids

MAIDAFLGKWCLISSEGFDEYMKELGVGMAMRKMGSMAKPDVYIIKDGDTITVKTESTFKTSQFSFKLGEKFEENTLDGRKTQTLVSLKDDGSLIQEQEWDGKKTIITRKLVDGQLVVECDMNGIKCVRVYQKA

15.1 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make FABP5 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here