Description
Fatty acid hydroxylase; part of the gene cluster that mediates the biosynthesis of verlamelin, a lipopeptide that exhibits antifungal activity against plant pathogenic fungi (PubMed:24848421). Verlamelin is a cyclic hexadepsipeptide and is bridged by ester bonding between a 5-hydroxytetradecanoic acid moiety and a carboxyl group on the terminal Val of amide-bonded tetradecanoyl-hexapeptide D-allo-Thr-D-Ala-L-Pro-L-Gln-D-Tyr-L-Val (PubMed:24848421). VlmA and vlmB are altogether regarded as essential components in the biosynthesis of 5-hydroxytetradecanoic acid (PubMed:24848421). VlmA catalyzes the hydroxylation at position C5 of tetradecanoic acid produced in primary metabolism, while the precise function of vlmB still remains to be solved (PubMed:24848421). To be loaded onto the waiting NRPS, 5-hydroxytetradecanoic acid is activated in the form of acyladenylate by the AMP-dependent ligase vlmC (PubMed:24848421). VlmS seems to accept the fatty-acyl intermediate onto the initial module to further elongate amino acid residues by the downstream modules (PubMed:24848421). In addition, in the last module at its C-terminus, vlmS contains a surplus condensation (C) domain that may be involved in cyclization, the last step to form verlamelin (PubMed:24848421).
Family
Belongs to the sterol desaturase family. TMEM195 subfamily.
Sequence
MPSTTQTTVQSIDSIDSIPTTIKRRQNDKTKTPKTKPVSKIPICPKNSSIPRLDQPSQHKFILLQSLLPITVHQLTTLVLSISRYDDYVHPFLLRLCVIIGYGYAFRFLLRREGLAIRTLGKKLGYLDGDHHPRDKVPRDSTRLNWSLPLTVGSRTVMCVLVAYDPSQQPINYLASLKWWAWLAVYLSLYPIILDFYYYCVHRAWHEVPCLWRFHRRHHTIKRPSILFTAYADSEQELFDIVGTPLLTFFTLKALHLPMDFYTWWICIQYIAYTEVMGHSGLRIYTTPPISCSWLLQRFGVELVIEDHDLHHRQGYRQARNYGKQTRIWDRLFGTCADRIETNPVNIQKGRRVMMHSINIPSLGN
Simulated SDS-PAGE
(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service