May play a role in the regulation of cell morphology and cytoskeletal organization (By similarity). Plays an important role in lipid droplet accumulation in liver and intestine during embryogenesis.

Belongs to the FIT family.

252 amino acids

MAAAVAGSLVDKLVCLWRQPYTRIYLPHLFFCISLVGSVLKNAELVPESYFSSSRNVLNLYFVKVSWGWTIVLLLPFIAYSNFYIKSHMFALRRLTSLLVATLVWYICTETFFYIEDITGSCYESNTMVVIRGEFDTKAACRKAGFFWDGFDISGHSFILSYSSLVIMEEMVPMLHIQPAYRNPPLDCLYLALNVIVAIWIWMFGCTSVYFHDIIDKILGTSCGILGWYMTYKVWYVKLFSPGLPPQPKQHT

29 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make fitm2 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here