Component of the IMD signaling pathway and is required for the host defense against Gram-negative bacteria. Interacts with Dredd, promotes cleavage of Dredd and is necessary and sufficient for enhancing Dredd-induced apoptosis (By similarity).

241 amino acids

MPGNHWYDILKKIACEGSSDIDELKGIFEKELSKRKFDSIRNIEDLIDVLERADMLSLHNVEPLRKMSSHKPKLIEALDRYGTPVSAPREPVNIYQEERLAEELRQHLRISQAFQILSAPGVAPPAFIPAAAPTPPPPQQNYITPAAFTDRKRTAVFNKISEELGRFWRIFGRKAGIGEGTMDDIEERYPRDLKSRILHLLKLIEEDDCHDPRQLLMRLCRALTECGRNDIKRKVEQIMSH

27.7 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make Fadd using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here