F-actin-capping proteins bind in a Ca(2+)-independent manner to the fast growing ends of actin filaments (barbed end) thereby blocking the exchange of subunits at these ends. Unlike other capping proteins (such as gelsolin and severin), these proteins do not sever actin filaments (By similarity).

Belongs to the F-actin-capping protein alpha subunit family.

262 amino acids

MSNDFDTIIKNIIKDSPAGELEEVYQDLITIAGENSKETIIDAIAEYNVENSIPIDVDGKDVIISKYNKQGTKFVDPVNGIQFSVDHLHQKGLDVEEYSADIDADQKKAITDLGNYLSTNFPGRATFAVLPLEEQSKTAIIIVSTKYNPSNFWNGHWKSEYVYDKTEGKLSGTIDIDVHYYEDGNVKFHSSKLVEETNIKDPVASIKELEHKFEQDLQESFTDLNEKQFKSLRRRLPITRARVNWGKAIGNYRLGRDAAQGK

29.7 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make CAP1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here