Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

208 amino acids

MSKVLFVKGNPRSVDESVSVKMYQTFVDTYKEANPNDEVIELDIYNEQLPYLDSTMLAGIFKAGQQLELTAEEEEARKVADRYLTQFVEADKVVFAFPLWNFTIPAALHTYMDYLARAGVTFNYTAEGPVGLMGDKKVALLNARGGYYSEGPAAQLEMSLNYMKTMVGFFGVQDPVTVVIEGHNAVPDQAEEIINKGLEEVKKVAQSF

23.2 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make azoR2 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here