May act as an adapter to facilitate the interaction of SnRK1 complex with effector proteins, conferring tissue- and stimulus-type specific differences in the SnRK1 regulation pathway.

Belongs to the FLZ family.

267 amino acids

MLKKRSRSKQALMAETNQSQNQKQSKTTPFPRLFTAFSSFKSFTENDAVASPTSILDTKPFSVLKNPFGSDNPKTQEPETRLKLEPKRIGLAIVDSLIQDETPEPGPRSGTILFGSQLRIRVPDSPISSSDFGIKTRNSQPETKKPGSESGLGSPRIISGYFPASDMELSEDYTCVTCHGPNPRTIHIFDNCIVESQPGVVFFRSSDPVNESDSDYSPPDSFLSCCCNCKKSLGPRDDIFMYRGDRAFCSSECRSIEMMMSEENDTK

29.6 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make FLZ8 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here