Secreted metalloproteinase that allows assimilation of proteinaceous substrates. Plays a pivotal role as a pathogenicity determinant during infections and contributes to the ability of the pathogen to persist within the mammalian host (By similarity).

Belongs to the peptidase M43B family.

271 amino acids

MRFSVLLTGLAAAGSIATAERTCGAVPPRAYEKEFTEALNSLSPEAASADLTAGITIDTYLHVLTSGQTGNIPDSQLQAQINAMNQHYSQAGVQFKLVKATRTDNANWASGRDEAGMKKALHMGTYSSLNIYFIPNLSSGLLGICYFPRANPSQTTIIMDGCMVRSGTVPGGETTNYNQGKTATHEVGHFLGLYHVFSENGSCVDADMVADTPAQSKKTSGCPSSQDSCPGGGVDSIHNYMDYSYDVCMNQFTPGQANRIAQSWRAFRAGH

28.9 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make ARB_05317 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here