Structural component which strengthens the primary cell wall (PubMed:11475326). Forms dendritic structures indicating a propensity for self-assembly through tyrosine cross-linking (PubMed:18256186, PubMed:21415277). Forms intermolecular cross-links exclusively by pulcherosine (three Tyr) (PubMed:18256186). Scaffold formation requires an unobstructed C-terminus of EXT3 (PubMed:18256186). Required for the correct positioning of the cell plate during cytokinesis in cells of the developing embryo (PubMed:12034904). Extensins contain a characteristic repeat of the pentapeptide Ser-Pro(4). For this particular extensin, a typical repeat of Ser-Pro(3) is found (PubMed:11475326).

Belongs to the extensin family.

431 amino acids

MGSPMASLVATLLVLTISLTFVSQSTANYFYSSPPPPVKHYTPPVKHYSPPPVYHSPPPPKKHYEYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKEKYVYKSPPPPPVHHYSPPHHPYLYKSPPPPYHY

49.2 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make EXT3 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here