May serve to lubricate the movement of the cellulose microfibrils during cell growth and wall extension and/or they may serve to maintain the fluid state of the slug cell wall.

Belongs to the expansin family. Expansin A subfamily.

286 amino acids

MKTFVLFVILLCLTFLSISKSETCPFSQSLVSGASATYYTDPNAGNCGYENLMGPLGPGNLFIAALGPNLYNNGKNCGQCFNISSPYTNRSVVIMATDSCPDSGYCQRSSHFDLSTQAFDVLGAQSIGVLEGLTYYKVPCGVNGNVKIMMKDGSNDYWTAFLIYNSKVTIKDVSVKITGKSTYTSLTQSSYNYWISPNMVPGSFDVRIESVGGEFIYITIPKVESRKQYETSSQFSVDGCVGTPSGPSGGLGSPSTGASIGTPSDASSLTLYALFSLTILFLVMLN

30.6 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make expl1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here