May cause loosening and extension of plant cell walls by disrupting non-covalent bonding between cellulose microfibrils and matrix glucans. No enzymatic activity has been found. May be required for rapid internodal elongation in deepwater rice during submergence (By similarity).

Belongs to the expansin family. Expansin B subfamily.

264 amino acids

MASRFQLILSTFVVIAAVTMLPRPCASIEFHRKLSSWSNGGATWYGAANGAGSDGGACGYQGAVFQAPFSSMIAAGSPSIYKSGLGCGSCYQVKCTGNSACSGNPVTVVLTDECPGGPCLSEPVHFDLSGTAFGAMANPGQADQLRAAGVLQIQYNRVPCNWGGVKLTFVVDVGSNPNYFAVLVKYENGDGDLSGVELMQTGAGAAWTQMQQSWGAVWKLNAGSALQAPFSIRLTSSSGKTLVASNVIPSGWKPGMSYISTVNF

27.4 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make EXPB15 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here