Description
May aid fertilization by loosening the cell wall of the stigma and style, thereby facilitating penetration of the pollen tube. Acts selectively on grass cell walls, which are relatively poor in pectins and xyloglucans and rich in glucuronoarabinoxylans and (1-3),(1-4)-beta-D-glucans, when compared with cell walls of other angiosperms, including other monocots (By similarity).
Family
Belongs to the expansin family. Expansin B subfamily.
Sequence
MTVVSIMWSLVQVQVLVAVALAFLVGGAWCGPPKVPPGKNITAKYGSDWLDAKATWYGKPTGAGPDDNGGGCGYKDVNKAPFNSMGACGNVPIFKDGLGCGSCFEIKCDKPAECSGKPVVVYITDMNYEPIAAYHFDLAGTAFGAMAKKGEEEKLRKAGIIDMQFRRVKCKYGSKVTFHLEKGCNPNYLALLVKYVDGDGDIVAVDIKEKGSDTYEPLKHSWGAIWRKDSDKPIKGPITVQLTTEGGTKTVYDDVIPAGWKPNTAYTAK
Simulated SDS-PAGE

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service