May aid fertilization by loosening the cell wall of the stigma and style, thereby facilitating penetration of the pollen tube. Acts selectively on grass cell walls, which are relatively poor in pectins and xyloglucans and rich in glucuronoarabinoxylans and (1-3),(1-4)-beta-D-glucans, when compared with cell walls of other angiosperms, including other monocots.

Belongs to the expansin family. Expansin B subfamily.

269 amino acids

MGSLANNIMVVGAVLAALVAGGSCGPPKVPPGPNITTNYNGKWLTARATWYGQPNGAGAPDNGGACGIKNVNLPPYSGMTACGNVPIFKDGKGCGSCYEVRCKEKPECSGNPVTVYITDMNYEPIAPYHFDLSGKAFGSLAKPGLNDKIRHCGIMDVEFRRVRCKYPAGQKIVFHIEKGCNPNYLAVLVKYVADDGDIVLMEIQDKLSAEWKPMKLSWGAIWRMDTAKALKGPFSIRLTSESGKKVIAKDVIPANWRPDAVYTSNVQFY

29.1 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make EXPB1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here