Degrades single-stranded DNA (ssDNA) in a highly processive manner. Also functions as a DNA deoxyribophosphodiesterase that releases deoxyribose-phosphate moieties following the cleavage of DNA at an apurinic/apyrimidinic (AP) site by either an AP endonuclease or AP lyase.

481 amino acids

MDIQKNTSLTFLFYDYETFGKNPALDKPSQFSCIQTDIDFNIIGSIQEIFCYPSVDYLPDPESVLITGISPKYTSLFGVNEFEFAKKIYSLFMKSDTCIIGYNNIYFDDEFTRNIFYRNFLNSYEWSWKNGNSRWDMLDLLRACYVLRPEGINWPRNEDNSVSLRLSDISLANNIVHNVAHNASSDVYATMNIAKLIKQKKPKLFNFFFKYRTKKAILTLIDVNSLNPIVYISRFFGVVNRYISYIVPILWHPINSNILVSIDLSQDVQKILNFFKRNSILNVNYKEIFLMGIRFIYVNRCPILIPTNVIRMKDRIRLRINYKLFQNNLVLLRKNIFLKKKLKKFLCSIAEAPKYNGSNVDLKMYNSFFSYIDNNVIKNIHSTLPKRIKINFMKYDNRINQLFILFLARYRPDMLDYSEKYFWIQRYLNIFSYANIQKYENKILKLIVKYKNHVRNVQLLEELFEYVKYTRKNFLKSIFTN

57.4 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make sbcB using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here