Bidirectionally degrades single-stranded DNA into large acid-insoluble oligonucleotides, which are then degraded further into small acid-soluble oligonucleotides.

Belongs to the XseB family.

78 amino acids

MADEQKQQSFEQALEQLEQLVNELEQGDLPLEQSLKKFEQAIALSRSSQQQLQQAEQKVTTLLAEQQSGNDESNGELM

8.8 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make xseB using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here