Pheromone produced by juveniles which activates a small number of vomeronasal organ sensory neurons and exhibits a powerful inhibitory effect on adult male mating behavior.

Belongs to the exocrine gland-secreted peptide family.

111 amino acids

MNSVPVMLFSISILLAAMLTEGRGLTQTQKESIFSAEHKSDLKSYLEMLVCRRLRDVPESVIHISKVSKEILPDDLLSTYLLELLVCFDKDKLVQSKGIVFNTIKRLLTNT

12.6 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make Esp22 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here