May induce host cell apoptosis and contribute of the establishment of a special cell cleavage process in which apoppotic bodies are rescued by the virus and differentiate to form large vesicles in which virion assembles.

Belongs to the peptidase C14A family.

288 amino acids

MSICYYDTVGREKRLLIINQRALALPNRTISSDGTCCDGDEYLLVDTFTKLNFKVQTIRNASKIVLETTVRNYIEKNVKRVACYFVVVLNDGNDADTILTTDGTYSLSELYALFTLYTVRAIPKVFLIQSCLGAKIDRSHCDRASCQCDQEEDAHPTSVCHDIFVNTVRRVIHACSRKSNGSTTTTETKCSDVATVVLTSPHTEETIIVYLRIEAYLRYGDTKCGCFMIEKFCKNLIKYGTRSSVHTTITMVQNEMQITDPKHVPIVQMNCTKLLFLGDENHIIMEEY

32.6 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make ORF73 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here