mRNA-binding protein involved in translation elongation. Has an important function at the level of mRNA turnover, probably acting downstream of decapping. Involved in actin dynamics and cell cycle progression, mRNA decay and probably in a pathway involved in stress response and maintenance of cell wall integrity. Functions as a regulator of apoptosis (By similarity).

Belongs to the eIF-5A family.

157 amino acids

MAEEEHVDFEGGEAGASLTFPMQCSALRKNGHVVIKGRPCKIVDMSTSKTGKHGHAKVHIVALDIFNGRKYEDMSPSTHNMDVPVVKRDEYQLVNIDDGYLNLMTTDGTTKDDVRLPEGELGNEIEEGFDEGRDLIITVVSAMGEETALACRDAPSS

17.2 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make tif51a using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here