Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is involved in protein synthesis of a specialized repertoire of mRNAs and, together with other initiation factors, stimulates binding of mRNA and methionyl-tRNAi to the 40S ribosome. The eIF-3 complex specifically targets and initiates translation of a subset of mRNAs involved in cell proliferation.

Belongs to the eIF-3 subunit L family.

550 amino acids

MVRDSFDGGHTGDPERDLAYEREHVRRDTMSDEVVPDDVAQYLIYFKRMIDEENVVEIHNLYEHGFPDLTERYFQQRLWPNEEAVENIVGSGNRIVAFSDSRIFIILYKELYFRHVYTRMQRGPSLAHRFDSYQNYQELFCEVLTPEKQPLSLQLPNVWLWDIIDEFVYQPFCLYKANPGKRSPEEYEDLLSIEQNQSAWNIYPVLNILYSLLAKSQIDEQLLAIREGRNPDDVADDFGRSALYFKLGYFSLIGLLRTHVLLGDYHQALKTVENLELDPKGLYNTVPSCLVTFHYFVGFSHMMMRNYGEATKIFVNCLLYIQRTKSVQQQNQQQKKNFQYDVIGKTNEQLYHLLAICLTLQPQRIDDSIQSQLYERTGERMNHMSNGNIDEFRLAFQQGCPKFLSPTTVVYEGPNQAKEPLLRQCNAFLEEIESQIMLPILRGYLKLYTTLPTRKLASFMDVSDADYDSFVGKLLSFKMIVNELGKECMDRCEIDDSTTDLDFYVDKDMIIIADTKVARRIGEYFIKQIQKLQEVNRKLKELPVIPAVSS

64.3 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make Bm1_25770 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here