Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is involved in protein synthesis of a specialized repertoire of mRNAs and, together with other initiation factors, stimulates binding of mRNA and methionyl-tRNAi to the 40S ribosome. The eIF-3 complex specifically targets and initiates translation of a subset of mRNAs involved in cell proliferation.

Belongs to the eIF-3 subunit L family.

476 amino acids

MSYEERVNAHPNLGDESDVEEEALVNDYREQVNFDDGMSELERTTSLGAASQTQDLQAQLAAAATPLEYQATLETKFASYDNYCSLFHYILNSEGPVELEVPSYYWAWDVIDEFIYQFESFCRYRNRVARSGSNEEEAQLLRENPNTWGCYSVLNVLYSLIQRSQINEQLAAIKRGEDPLTVAGEYGSRPLYKMLGYFSIIGLLRVHCLLGDFSLALKTLDDIEMNKKAMFARVMAAHFTTYYYVGFSYMMMRRYGDAIRMFSHILVYVSRTKNFQKGGNSYDAIAKKNDQMYALIAICVALHPTRLDDTIHSALREKYGEQLIRLQHGGPEALPLFEELFRSACPKFISPTPPDFDNPAVNVDPVDHHTAIFMDEVKNTLYNPTIRSYLKLYTTMDLKKLAGFLEVEPEKLRSWLLVNKQRSRQVRWVEGGLLEGEPVNANDLDYALENDLIHVSETKAGRRLVDWYLRNLARVY

54.8 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make ACLA_069410 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here