Description
Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is involved in protein synthesis of a specialized repertoire of mRNAs and, together with other initiation factors, stimulates binding of mRNA and methionyl-tRNAi to the 40S ribosome. The eIF-3 complex specifically targets and initiates translation of a subset of mRNAs involved in cell proliferation.
Family
Belongs to the eIF-3 subunit J family.
Sequence
MEDDWEALAEQKAEQLFAKADVNKWAGEDEDDVKDNWEDDDEEEEKKDAPKQEDTPTKNAKPKKAAQQKKLKKEDLERLQREEEEFANMTPEQQLAEKRRLQKLQEENDLKTAMETLGITPMSTGNGIDGMHPTTKEEFTELAEAISKKLANYRASTEYQGFLEELLLKLFASLSSNNIRKAKTTLDNLYLEKQKVEKGDKPKKTKGIKVKAKLRVEGENTTLNEYETKYDDYDDYDDFM
Simulated SDS-PAGE

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service