About Products Protein Database Contact

Protein expression services for tif35 | Eukaryotic translation initiation factor 3 subunit G

Description
RNA-binding component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is involved in protein synthesis of a specialized repertoire of mRNAs and, together with other initiation factors, stimulates binding of mRNA and methionyl-tRNAi to the 40S ribosome. The eIF-3 complex specifically targets and initiates translation of a subset of mRNAs involved in cell proliferation. This subunit can bind 18S rRNA.
Family
Belongs to the eIF-3 subunit G family.
Species
Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)
Length
288 amino acids
Sequence
MSRVANNRDWADDEDLEDSNELPQSTTTTNKDGTQTIVTWRFNDDGKKVKTTRRIRFTKVKEIVNPRVAERKSWGKFGLSQKDAAGPASDTTSVGENIIFRPSTNWRKDAKEEVSDAGAMKNKLKDKQVKCRICSGEHFTAKCPFKGTMAPLGEEGAVDVAAGHADTPEGPGGLGAGKSSYVPPHLRNGGAAGGERMGGGKFERDDLATLRVTNVSEMAEEQELRDMFERFGRVTRVFLAKDRETGLAKGFAFISFQERSDAAKACEKMDGYGFKHLILRVEFAKKAT
Mass
31.7 kDa
Simulated SDS-PAGE
Western blot of tif35 recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make tif35 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here