Description
RNA-binding component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is involved in protein synthesis of a specialized repertoire of mRNAs and, together with other initiation factors, stimulates binding of mRNA and methionyl-tRNAi to the 40S ribosome. The eIF-3 complex specifically targets and initiates translation of a subset of mRNAs involved in cell proliferation. This subunit can bind 18S rRNA.
Family
Belongs to the eIF-3 subunit G family.
Species
Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970)
Sequence
MATQTKHDWADDEDLEETTTTTAPTTDLPPPQKIQNKDGTWTIIEYRINDLGQKVKATRRVRYVVRREVVNPRVAERKTWAKFGDSANDPKGPAPDTTTVGENIIFRPSVNWRKEAKDEANDPNAQAMKDKLKDKKVKCRICNGEHFTARCPYKDTMAPIGEAGPADVAAGMGDEPAAAGPAAAGAAGAGKKGSYVPPAMRAGAGGAQGERMGGKYGERDDLATLRVTNVSEMAEEQELRDMFERFGRVTRVFLAKDRDTGMAKGFAFISYADRDDAVKACNKMDGFGFRHLILRVEFAKKAQ
Simulated SDS-PAGE
(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service