About Products Protein Database Contact

Protein expression services for tif211 | Eukaryotic translation initiation factor 2 subunit alpha

Description
eIF-2 functions in the early steps of protein synthesis by forming a ternary complex with GTP and initiator tRNA. This complex binds to a 40S ribosomal subunit, followed by mRNA binding to form a 43S preinitiation complex. Junction of the 60S ribosomal subunit to form the 80S initiation complex is preceded by hydrolysis of the GTP bound to eIF-2 and release of an eIF-2-GDP binary complex. In order for eIF-2 to recycle and catalyze another round of initiation, the GDP bound to eIF-2 must exchange with GTP by way of a reaction catalyzed by eIF-2B (By similarity).
Family
Belongs to the eIF-2-alpha family.
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Length
306 amino acids
Sequence
MSTTSCRMYENRFPEVDELVVVNVRQIQEMGAYVKLLEYDNIEGMVLLSELSRRRIRSVQKHIRVGRNEVVVVLRVDKEKGYIDLSKRRVSPEDVVKCEERFNKSKAVHSIMRHIAEKHNVPLETMYTTIGWPLYRKYGHAYDAFKLAISNPDHVFEGLEPPKSGVINDLLAQISRRLTPQPIKIRADVEVTCFGYEGINAIKAALKAAEDVHTEEVPIKVKLVAPPLYVLLTNALDKSLGLKKLEEAIGAIEKSITASNGTCTVKMKPKAVSETDELELADLMKKFEKENAEISGDEEDDQSGSE
Mass
34.5 kDa
Simulated SDS-PAGE
Western blot of tif211 recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make tif211 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here