Protein expression services for WIN1 | Ethylene-responsive transcription factor WIN1
Description
Promotes cuticle formation by inducing the expression of enzymes involved in wax biosynthesis (PubMed:15070782, PubMed:15319479). Confers drought resistance (PubMed:15319479). Acts as a transcriptional activator. Binds to the GCC-box pathogenesis-related promoter element. May be involved in the regulation of gene expression by stress factors and by components of stress signal transduction pathways (By similarity).
Family
Belongs to the AP2/ERF transcription factor family. ERF subfamily.
Species
Arabidopsis thaliana
Length
199 amino acids
Sequence
MVQTKKFRGVRQRHWGSWVAEIRHPLLKRRIWLGTFETAEEAARAYDEAAVLMSGRNAKTNFPLNNNNTGETSEGKTDISASSTMSSSTSSSSLSSILSAKLRKCCKSPSPSLTCLRLDTASSHIGVWQKRAGSKSDSSWVMTVELGPASSSQETTSKASQDAILAPTTEVEIGGSREEVLDEEEKVALQMIEELLNTN
Mass
21.7 kDa
Simulated SDS-PAGE
(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make WIN1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)
Order Here