The steroid hormones and their receptors are involved in the regulation of eukaryotic gene expression and affect cellular proliferation and differentiation in target tissues.

Belongs to the nuclear hormone receptor family. NR3 subfamily.

565 amino acids

MAVASSPEKDQPLLQLQKVDSSRVGGQVLSPTLSSSLETSQPICITSPYTDLGHDFPTIPFYSPTIFSYAGPSISDCTSVHQSLNPSLFWPSRGHMGSPIPLHHSQHGQPIQSPWVEISPLDNVLKTKQDGASLPLAVVPVRHKSARRRSQESEEAVVTSGGKTDLHYCAVCHDYASGYHYGVWSCEGCKAFFKRSIQRDNEYICPATNECTIDKNRRKSCQACRLRKCYEVGMTKCGMRKERGNYRSPQMRRMTRLTSQGRTDSSSVLTGSAVVSLNAPQPSALTSEQLIERLMEAEPPEIYLMKDMKKPLTEAKVMMSLTNLADKELVHMITWAKKIPGFVELGLLDQVHLLECCWLEVLMVGLMWRSVDHPGKLVFSPDLSLSREEGSCVQGFAEIFDMLLAATSRVRELKLQREEYVCLKAMILLNSNMCLSSSESSSKLLRLLDAVTDALVSAIGKTVLSFRQQYTRLAHLLMLLSHIRHVSNKGMDHLHCMKMKNMVPLYDLLLEMLDAHIMHSSRLPRRSPEQEPEDQADAPAPPHSSGSGPSYTWTPSSSEGAGEPQ

62.9 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make esr3 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here