Esterase; part of the gene cluster that mediates the biosynthesis of the mycotoxin citrinin, a hepato-nephrotoxic compound to humans due to inhibition of respiration complex III (PubMed:17586673, PubMed:19012408, PubMed:28238725, PubMed:19111642, PubMed:27913218). The pathway begins with the synthesis of a keto-aldehyde intermediate by the citrinin PKS (pksCT) from successive condensations of 4 malonyl-CoA units, presumably with a simple acetyl-CoA starter unit (PubMed:28238725). Release of the keto-aldehyde intermediate is consistent with the presence of the C-terminal reductive release domain (PubMed:28238725). The exact catalytic role of the hydrolase mpl1 remains mysterious, although it is clear that it increases the productivity of the PKS and performs the earliest non-PKS step during citrinin biosynthesis (PubMed:27913218). Mpl2 then catalyzes the oxidation of the C-12 methyl of the ketone intermediate to an alcohol intermediate which is further oxidized by the oxidoreductase mpl7 to produce a bisaldehyde intermediate (PubMed:27913218). The fourth catalytic step is catalyzed by the mpl4 aldehyde dehydrogenase (PubMed:27913218). The final transformation is the reduction of C-3 by mpl6 to provide the chemically stable citrinin nucleus (PubMed:27913218).

Belongs to the LovG family.

313 amino acids

MKGQTGLRSLALLYISPLYILERLPLKLSAPDTLVVRGSFIVPTEPLYPSITMVQTNLEVVDDTLHLPRILCLHGGGSNAAIFQAQCRRLIAQLRSEFRFVFAQAPFLSDAEPNVMSVYSQWGPFRRWLRWCPDHPEIRPEDAIRAIDDCLEDVKRQDDAKGATGAWVGLLGFSQGAKMCASLLYRQQIRQELRGRSFAGSDYRFGVLLAGRAPLVSLDPDLDLNSSLPDVSQITDAKYHGPSQDVLRIPTVHVHGMRDPHVDLHRQLFEEFCAPESRRLVEWDGDHRVPLKYNDVSLVAYQIRELATQTGAP

35.2 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make mpl1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here