Description
Esterase; part of the gene cluster that mediates the biosynthesis of monakolin K, also known as lovastatin, and which acts as a potent competitive inhibitor of HMG-CoA reductase (PubMed:18578535). Monakolin K biosynthesis is performed in two stages (PubMed:19693441). The first stage is catalyzed by the nonaketide synthase mokA, which belongs to type I polyketide synthases and catalyzes the iterative nine-step formation of the polyketide (PubMed:18578535, PubMed:19693441). This PKS stage completed by the action of dehydrogenase mokE, which catalyzes the NADPH-dependent reduction of the unsaturated tetra-, penta- and heptaketide intermediates that arise during the mokA-mediated biosynthesis of the nonaketide chain and leads to dihydromonacolin L (PubMed:19693441). Covalently bound dihydromonacolin L is released from mokA by the mokD esterase (By similarity). Conversion of dihydromonacolin L into monacolin L and then monacolin J is subsequently performed with the participation of molecular oxygen and P450 monoogygenase mokC (PubMed:19693441). Finally, mokF performs the conversion of monacoline J to monacoline K through the addition of the side-chain diketide moiety (2R)-2-methylbutanoate produced by the diketide synthase mokB (PubMed:19693441).
Family
Belongs to the LovG family.
Sequence
MRIQRTPAPPKAPRALLCVHGAGCSPAIFRVQLSKLRAALREDFEFVYATAPFPSAPGPGILPTFEGLGPYYTWFEGSPSGAAAKGDNSNSNDSNSSPTVHDRLAAVHEPVRRAIAEWQTQNPSIPIVGTVSFSEGALVTALLLWQQQMGRIPWLPVMQVAMFICCWYQHEATQYMREEVGCGGDGGIDGEKLVIRGVLSLHLQGRDDFALAGSKMVVAQHFVPGEAQVLEFAGRHHFPNRPRDVLETVKRFRQLCVRARVIG
Simulated SDS-PAGE

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service