Esterase; part of the gene cluster that mediates the biosynthesis of the antibiotic 2,4-dihydroxy-3-methyl-6-(2-oxopropyl)benzaldehyde (DHMBA) and its derivatives (PubMed:22510154, PubMed:23001671). The direct non-reducing polyketide synthase dbaI product is 2,4-dihydroxy-3-methyl-6-(2-oxopropyl)benzaldehyde (DHMBA), produced by condensation of one acetyl-CoA starter unit with 4 malonyl-CoA units and one methylation step (PubMed:22510154). The FAD-dependent monooxygenase dbaH is responsible for the synthesis of yellow pigments derived from the oxidation of DHMBA (PubMed:23001671). The roles of dbaB, C, E and F have still to be determined (Probable).

Belongs to the LovG family.

278 amino acids

MTIRIPSGEEADYTLHLPRILCLHGGGTNARIFRMQCRVLERFLRSTFRFVYAEAPFAAQPGSDVTSVYKDHGPFKAWLRCTAADPDRSAQEVVKKINLSIATAMYDDDMRGATGEWIALLGFSQGAKVAASILYAQQTIQQRLGERAATRPRFRFAVLMAGRGPLVWLLPETSSGPGSIPMGLVDAASPSMLDSEPELPTDSTEHMLRLPTLHVHGLRDPGLSLHRRLLRSYCQSDSVSLVEWEGEHRVPLKTKDVTAVVDQIYALARDTGVLDSWC

30.8 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make dbaE using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here