Esterase; part of the gene cluster that mediates the biosynthesis of asperlin, a polyketide showing anti-inflammatory, antitumor and antibiotic activities (PubMed:30339758). The first step of the asperlin biosynthesis is the production of the intermediate 2,4,6-octatrienoic acid by the highly redusing polyketide synthase alnA with cleavage of the PKS product by the esterase alnB (PubMed:30339758). 2,4,6-octatrienoic acid is further converted to asperlin via several steps involving the remaining enzymes from the cluster (PubMed:30339758).

Belongs to the LovG family.

284 amino acids

MPKILCLHGYGTSASILQHQLGPFMAAADPSYEFVFLEGEIECQKAQGLGPFVKGPFLCYNESFAPADIQESCDLIDEMIQAAGPFDGIIGFSQGGSVALSYLLQRQIDGHPPPFRWAVFFSTVIAFAPNDTFGSNILANLTDHEIRLLDGYPATDLSSLHPLTRALCETTAQTFYSAKTGGFISPNTPIAEFSKRDDPSQPRVFHPALLGDRIPIPTVHITGRKDNSLMVGLSVLVQGLCDQRLIRSLTHSGGHNVPRSADDVRAAWAAVDWAIQHSQKQHIW

31 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make alnB using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here