Receptor tyrosine kinase which binds promiscuously transmembrane ephrin-B family ligands residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. The signaling pathway downstream of the receptor is referred to as forward signaling while the signaling pathway downstream of the ephrin ligand is referred to as reverse signaling. May play a role in axon guidance during nervous system development. May also play an important redundant role with other ephrin-B receptors in development and maturation of dendritic spines and synapse formation. More generally, may play a role in targeted cell migration and adhesion. Upon activation by ephrin-B ligands activates the MAPK/ERK and the JNK signaling cascades to regulate cell migration and adhesion respectively (By similarity).

Belongs to the protein kinase superfamily. Tyr protein kinase family. Ephrin receptor subfamily.

single

984 amino acids

ETLMDTRTATAELGWTANPPSGWEEVSGYDENLNTIRTYQVCNVFEPNQNNWLLTTFINRRGAHRIYTEMRFTVRDCSSLPNVPGSCKETFNLYYYETDSVIATKKSAFWTEAPYLKVDTIAADESFSQVDFGGRLMKGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFFKKCPSVVQNFAIFPETMTGAESTSLVTARGTCIPNAEEVDVPIKLYCNGDGEWMVPIGRCTCKAGYEPENNVACRACPAGTFKASQGAGLCARCPPNSRSSAEASPLCACRNGYFRADLDPPTAACTSVPSGPRNVISIVNETSIILEWNPPRETGGRDDVTYNIVCKKCRADRRACSRCDDNVEFVPRQLGLTETRVFISSLWAHTPYTFEIQAVNGVSNKSPFPPQHVSVNITTNQAAPSTVPIMHQVSATMRSITLSWPQPEQPNGIILDYELRYYEKLSRICTPDVSGTVGSRPAADHNEYNSSVARSQTNTARLEGLRPGMVYVVQVRARTVAGYGKYSGKMCFQTLTDDDYKSELREQLPLIAGSAAAGVVFIVSLVAISIVCSRKRAYSKEVVYSDKLQHYSTGRGSPGMKIYIDPFTYEDPNEAVREFAKEIDVSFVKIEEVIGAGEFGEVYKGRLKLPGKREIYVAIKTLKAGYSEKQRRDFLSEASIMGQFDHPNIIRLEGVVTKSRPVMIITEFMENGALDSFLRQNDGQFTVIQLVGMLRGIAAGMKYLAEMNYVHRDLAARNILVNSNLVCKVSDFGLSRYLQDDTSDPTYTSSLGGKIPVRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSFGERPYWDMSNQDVINAIEQDYRLPPPMDCPAALHQLMLDCWQKDRNTRPRLAEIVNTLDKMIRNPASLKTVATITAVPSQPLLDRSIPDFTAFTSVEDWLSAVKMSQYRDNFLSAGFTSLQLVAQMTSEDLLRIGVTLAGHQKKILNSIQSMRVQMSQSPTSMA

109.6 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make EPHB1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here