Cytotoxin and helminthotoxin with low-efficiency ribonuclease activity. Possesses a wide variety of biological activities. Exhibits antibacterial activity (By similarity).

Belongs to the pancreatic ribonuclease family.

160 amino acids

MVPKLFTPQICLLLLLGLMGVEGSLHARPPQFTKAQWFAIQHINVNPPRCTIAMRVINNYQRRCKNQNTFLRTTFANTVNVCRNRSIRCPRNRTLHNCHRSSYRVPLLHCDLINPGAQNISTCRYADRPGRRFYVVACESRDPRDSPRYPVVPVHLDTII

18.5 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make RNASE3 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here