Involved in the final reduction of the elongation cycle of fatty acid synthesis (FAS II). Catalyzes the reduction of a carbon-carbon double bond in an enoyl moiety that is covalently linked to an acyl carrier protein (ACP).

Belongs to the TER reductase family.

402 amino acids

MHIKPIIQGVVARSAHPYGCEQAVLQQIQYVKQANPIKSGPKRVLILGASSGFGLAARIALTFGGAQADTIGVSFERAPSETQTGSAGYYNNLFFKQHAEQAGRIAVNLEGDVFSVDMREQVIEAIETYFEGEVDLIIYSIASGMRRKPRSEKADPEFWRSAIKPIGEAVSGATLLLENDTWIETTLQPASEEEIEGTLRVMGGDDWENWIDTLINAESLAEGCKTIAFSYMGPDVTHPIYLDGTLGRAKIDLHQTSHALNLKLANFDGGAYAVVCKALVTKASVFIPGLSPYLLALYQVMKNKGTHEGCIEQMQRLFSDKLYGHSRIPLDSERLIRMDDWEMNPDTQVQVRERLQQMNASNFQQLGDYAGFKREFMQLNGFEFDQIDYSQSVDMHNFINKK

44.8 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make fabV2 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here