Description
Enoyl reductase; part of the gene cluster that mediates the biosynthesis of chaetoglobosin A which has a unique inhibitory activity against actin polymerization in mammalian cells (PubMed:23611317). The first step of the pathway is the synthesis of prochaetoglobosin I via condensation of one acetyl-CoA, 8 malonyl-CoA, and a L-tryptophan molecule by the PKS-NRPS hybrid synthetase CHGG_01239, followed by reduction of backbone double bond to install desired geometry by the enoyl reductase CHGG_01240 (PubMed:23611317). Further multiple oxidation steps performed by the cytochrome P450 monooxygenases CHGG_01242-1 and CHGG_01243, as well as by the FAD-linked oxidoreductase CHGG_01242-2, lead to the formation of chaetoglobosin A (PubMed:23611317). Depending on the order of action of these reductases, distinct intermediates can be identified (PubMed:23611317). Within the pathway, the cytochrome P450 monooxygenase CHGG_01242-1 catalyzes a stereospecific epoxidation on prochaetoglobosin I, cytoglobosin D, and chaetoglobosin J intermediates (PubMed:23611317). The FAD-linked oxidoreductase CHGG_01242-2 performs dehydrogenation of the C-20 hydroxyl groups in the 20-dihyrochaetoglobosin A and cytoglobosin D intermediates (PubMed:23611317). Finally, the cytochrome P450 monooxygenase CHGG_01243 can catalyze the stereospecific dihydroxylation of prochaetoglobosin I and prochaetoglobosin IV at C-19 and C-20, respectively (PubMed:23611317).
Family
Belongs to the zinc-containing alcohol dehydrogenase family.
Species
Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970)
Sequence
MGSFEIPEKHTALLQGEGGSLVIARDVPLPTLGPGHLLVKTAAVALNPCDFKTPAAFPNPGYYNGCDFAGTVVALGSDNIRDGGPWKIGDRIFGAIHGANPSDWDSGSHAEYVKAVSVFSYRIPDWMTFEEAAGLSPCCIATMGVSLFKALELPGTFEEPATKPLDVLIYGGSSSVGSLGIQMVKLTGHRLGHRCITTCSPKNFDLVKSYGADEVFDYKSPTCAQDIRKATRNCLKYAVDPFGEVKTMAICTEAIGRAGGRYSALEKFQEDVCDRKTVKRELTMGAIIIGHGLDLGGRYTRPHSPEMRAWGIEWYKSIQRLVDARKFKPHPIRVLKGGFEDMLEGLAMLKRREISAEKLVVSLDPAVSGLTADSTAR
Simulated SDS-PAGE

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service