Bifunctional enzyme that catalyzes the enolization of 2,3-diketo-5-methylthiopentyl-1-phosphate (DK-MTP-1-P) into the intermediate 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate (HK-MTPenyl-1-P), which is then dephosphorylated to form the acireductone 1,2-dihydroxy-3-keto-5-methylthiopentene (DHK-MTPene).

Belongs to the HAD-like hydrolase superfamily. MasA/MtnC family.

235 amino acids

MTASTDAIDSVLLDIEGTTIPVAFVHQVLFPYARAAMPGLLAQRADDPAVRAAVADIAALAPGVPPLDQLNAWMDRDEKIGPLKALQGLAWEEGYRTGALRATLYPDVVPALRRWRAAGLRLAVYSSGSEAAQRLIYGHTTDGDVAGLFSGFYDLRIGGKRAAGSYRAILAETGWAAGRTLFLSDITAELDAAEEAGLRTCQLVRPEDGTVAGDRHPVATTLDDVARRFALPVAA

25 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make mtnC using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here