Component of the NuA4 histone acetyltransferase complex which is involved in transcriptional activation of selected genes principally by acetylation of nucleosomal histone H4 and H2A. The NuA4 complex is also involved in DNA repair. Involved in gene silencing by neighboring heterochromatin, blockage of the silencing spreading along the chromosome, and required for cell cycle progression through G2/M (By similarity).

Belongs to the enhancer of polycomb family.

557 amino acids

MSSVSKNARAYRQRKVGIKTVMPIYFERDIPDFDEEASLQRTVPLVESGVEKEEEEEKHLQQVINEAHEAIVRGSEKKLIIPTREAKNIGIIDKYYKKNFILPKTLIRFSLTVEECTNPEYCMDEHDTEYFLKLKQAQPSLSKFSELDFEIVMQTFEEEINQNQPFLSMDTSQILPLSELITSFELKDVLYLKPLASQVYPYWRERRISKGGLPIMAKAQVGDDKDDDDPYVCFRRREIRQARKTRRSDAQSYDRLRRLRQSMETSLQLLEQVYKREQKKLQALEDDYAIFQKRCLVKKLKRTLNIKDSDELLINPKRRPIEVKPAAPVPTPAPPVKTSPHPASYRPQPTRNVEVRPLLMLDDVQSAQITQFQIRLQQRLTKKEQLDRNWVDLLETPSTVIHTNYPDSFYRNIIPYYSGKETKQSHNQLSIPSSTPSTPLSDNGPTYSTPHSSLSNFNTCDSLSFSSNNSLYGYSTLLHPRNPICVRQRIGRGGRLMLDRTRALPVHRLSKPKSRVEDRWLFDIPFDADDTIILDDESDASIMFRASLLNDDMGTQS

64.6 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make epl1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here