Protein expression services for ecfA1 | Energy-coupling factor transporter ATP-binding protein EcfA1
Description
ATP-binding (A) component of a common energy-coupling factor (ECF) ABC-transporter complex. Unlike classic ABC transporters this ECF transporter provides the energy necessary to transport a number of different substrates.
Family
Belongs to the ABC transporter superfamily. Energy-coupling factor EcfA family.
Species
Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
Length
285 amino acids
Sequence
MKDIIVKANDVEYAYKKNSDETPKVLVLKELNTEICEGEFVAVIGRNGSGKSTFARLLNAILIPTRGVLYIGGKETYTEANLWEIRRTVGMVFQNPDNQIIATSVEEDVAFGPENIGIPSDEIVKRVEEALRSVGLEEYKKALPHHLSGGQKQRVAIAGILAMKPKCIVLDEATSMLDPSGRKEVLKVLRDLNEKENITIIHITHYMEEAILAKRILVMDEGKIVMDGNPRQIFSKVEEIKALGLDVPQVAELFHELKKDGYNVPDNILTVEEAVQCLAEMIAKA
Mass
31.7 kDa
Simulated SDS-PAGE
(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make ecfA1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)
Order Here