Toxic component of a type II toxin-antitoxin (TA) system. A sequence-specific endoribonuclease, it cuts between the first and second nucleotides of 5'-UACAU-3' (PubMed:19251861, PubMed:23994560). Cleaves the artifical ssDNA-RNA substrate 5'-AAGTCrUrACATCAG-3' between rU and rA in vitro (PubMed:23994560). Originally found to be a ribosome-independent, with a consensus sequence of 5'-[ACG]UU[ACG]-3' in single-stranded RNA (PubMed:17933891, PubMed:19168622). Its overexpression inhibits protein synthesis and induces bacterial stasis, it is neutralized by coexpression with cognate antitoxin MazE (PubMed:17933891, PubMed:19168622, PubMed:19251861). Not all mRNAs are equally susceptible in vivo (gyrB, recA and sarA for example are not degraded), while no degradation of rRNA has been seen (PubMed:19168622).

Belongs to the PemK/MazF family.

120 amino acids

MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIRTLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN

13.4 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make mazF using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here