Involved in maceration and soft-rotting of plant tissue. Hydrolyzes the 1,4-alpha glycosidic bonds of de-esterified pectate in the smooth region of the plant cell wall.

Belongs to the glycosyl hydrolase 28 family.

363 amino acids

MVSYLFVLGALASVAIASPVPELKARASCTFTDAASAIKGKASCTTIVLNNIAVPAGTTLDMTGLKSGTHVSFSGKTTFGYKEWEGPLISFSGSNVVIDGASGHSIDCQGSRWWDSKGGNGGKTKPKFFYAHSLKDSTIRGLHTLNTPVQAFSINGAANLGVYDVSVDNSAGDSAGGHNTDAFDVGSSTGVYISGADVKNQDDCLAVNSGTNITFTGGTCSGGHGLSIGSVGGRKDNVVKSVSITNSKIINSDNGVRIKTVAGATGPVSDITYSGITLSNIAKYGIVIEQDYENGSPTGKPTSGVPISGLTLSKISGSVSSSATPVYILCASCTNWKWSGVSVTGGKKSSKCTGIPSGSGAAC

36.7 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make PG1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here