DNA repair enzyme involved in the repair of deaminated bases. Selectively cleaves double-stranded DNA at the second phosphodiester bond 3' to a deoxyinosine leaving behind the intact lesion on the nicked DNA.

Belongs to the endonuclease V family.

229 amino acids

MTTVRIPAGWPATEEEARAVQDELRGRVILDEPGPPPGTGRVTGVDVAYDDERDVVVAAAVVLDAATLDVVAEATAVGEVSFPYVPGLLAFREIPTVLAALDALPCPPGLIVCDGYGVAHPRRFGLASHLGVLTGLPTIGVAKNPFTFSYEDPGAPRGSAAPLLAGADEVGRALRTQSGVKPVFVSVGHRVDLDHACAHTLALTPKYRIPETTRRADSLCRRALKEATA

24 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make nfi using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here