Bifunctional DNA N-glycosylase with associated apurinic/apyrimidinic (AP) lyase function that catalyzes the first step in base excision repair (BER), the primary repair pathway for the repair of oxidative DNA damage. The DNA N-glycosylase activity releases the damaged DNA base from DNA by cleaving the N-glycosidic bond, leaving an AP site. The AP-lyase activity cleaves the phosphodiester bond 3' to the AP site by a beta-elimination. Primarily recognizes and repairs oxidative base damage of pyrimidines. Has also 8-oxo-7,8-dihydroguanine (8-oxoG) DNA glycosylase activity. Also involved in the repair of 7-methylguanine lesions, although it cannot directly repair alkylated DNA bases. Probably does so via excision of methylformamidopyrimidine (mFapy) lesions, a spontaneous processing product of 7-methylguanine.

Belongs to the Nth/MutY family.

355 amino acids

MSKDYGTPPENWREVYDEICKMKAKVVAPVDVQGCHTLGERNDPKKFRFQTLVALMLSSQTKDIVLGPTMRNLKEKLAGGLCLEDIQNIDEVSLNKLIEKVGFHNRKTIYLKQMARILSEKFQGDIPDTVEDLMTLPGVGPKMGYLCMSIAWNKTVGIGVDVHVHRICNLLHWCNTKTEEQTRAALQSWLPKELWFELNHTLVGFGQTICLPRGRRCDMCTLSSKGLCPSAFKEKSGITITKRKVKTIKRVKKRPASESPPLSPLSLPTDDLYYQSIEDKSLIKLEDLDPVDSISHMNEPLKKEPAADIDVDQKPPVAFHSTTKETRSLRRSKRVAKKSSQYFSQQSLQDIEDLV

40.2 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make nth1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here