About Products Protein Database Contact

Protein expression services for NEIL2 | Endonuclease 8-like 2

Description
Involved in base excision repair of DNA damaged by oxidation or by mutagenic agents. Has DNA glycosylase activity towards 5-hydroxyuracil and other oxidized derivatives of cytosine with a preference for mismatched double-stranded DNA (DNA bubbles). Has low or no DNA glycosylase activity towards thymine glycol, 2-hydroxyadenine, hypoxanthine and 8-oxoguanine. Has AP (apurinic/apyrimidinic) lyase activity and introduces nicks in the DNA strand. Cleaves the DNA backbone by beta-delta elimination to generate a single-strand break at the site of the removed base with both 3'- and 5'-phosphates (By similarity).
Family
Belongs to the FPG family.
Species
Pongo abelii
Length
332 amino acids
Sequence
MPEGPLVRKFHHLVSPFVGQQVVKTGGSSKKLQPASLQCLWLQDTQVNGKKLFLRFDPDEEMGPPGSSPPPEPPQKEAQKEGAADPKQVGEPSGQKTPDGSSQSAELVPQGEDDSEYLERDAPAGDAGRWLRVSFGLFGSVWVNEFSRAKQANKRGDWRDPSPRLVLHCGGGGFLAFYNCQMSWSSSPVVTPTCDILSEKFHRGQALEALGQAQPVCYTLLDQRYFSGLGNIIKNEALYRAGIHPLSLGSVLSASRREVLVDHVVEFSTAWLQGKFQGRPQRTQVYQREQCPAGHQVMKEAFGPQDGLQRLTWWCPQCQPQLSEEPEQRQFS
Mass
36.8 kDa
Simulated SDS-PAGE
Western blot of NEIL2 recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make NEIL2 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here