Functions as a peptidoglycan terminase that cleaves nascent peptidoglycan strands endolytically to terminate their elongation.

Belongs to the transglycosylase MltG family.

360 amino acids

MYINQQKKSFFNKKRIILSSIVVLFLIIGGAFLYGKSLLEPVEKDSKTTVNINIPSGSSVSAIASILKKNDVIKSEKAFQYYVKYKGASGFQAGFYHLNKGMDLDAIIQKLTSGATGYAFQITVTEGAQLTQIAAAIADETKYSKKQVIAKLDDETFINQLKKEFPDTVTNDVFNKNIKHPLEGYLFPATYPFNDPDTSLEDIIKAMIKQTNSYVETYKSEMKKNKVSVHKLLTMASLIEEEATEKADRHKIASVFYNRLKKKMPLQTDPTVLYAAGKHKDRVLYKDLEIDSPYNTYKNTGLTPGPIANAGMSSWEAALHPDKTDYLYFLAKSNGEVVFTKTLKEHNKAKEKYISSKNEK

40.5 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make mltG using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here