Chitosanase catalyzing the endo-type cleavage of chitosan, the deacylated form of chitin. Chitosanase may be crucial in the degradation of the deacetylated portion of chitin in the fungal cell wall. Chitoolisaccharides produced by the hydrolysis of partially N-acetylated chitosan are known to have many biological activities, including antibacterial activity, immune-enhancing effects, and ellicitor activity (By similarity).

Belongs to the glycosyl hydrolase 75 family.

240 amino acids

MRLSEILAVALVTGATAYDLPDNLKQIYEKHKGKCSKVYQKGFTNGGHSDGKSFEYCGDIEGAIFMHSSAKGGQYTNMDVDCDGANNSAGKCSNDPSGQGVTAFKDEVKKFGIPDLDANLHPYIVFGNEEHSPQFKPQKYGMEPLSVMAVVCNGKLHYGIWGDTNGGTSTGEASLSMAELCFPEEKPDGDHGHDDNDVLYIGFTGKDAVLERVPLEGKKTEDFEDSIKSIGDKLVAGLKA

25.8 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make csnB using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here