Secreted chitinase involved in the degradation of chitin, a component of the cell walls of fungi and exoskeletal elements of some animals (including worms and arthropods). Participates in the infection process and directly acts in the penetration process of the host cuticle.

Belongs to the glycosyl hydrolase 18 family. Chitinase class V subfamily.

423 amino acids

MPSLFAQSLAIIATLQATLGLATPVSAPDTVIGKHAGGYVNAVYFTNWGIYGRNYQPADLPASQISHVLYSFLNLSNNGTVYSGDSWADIDKHYPNDSWNDVGTNVYGCVKQLYLLKKANRNMKTMLSIGGWTWSTNFPAAASTAATRSNFAKSAVTIMKDWGFDGIDVDWEYPADDVQATNMVLLLQAIREELDAYAAKFAQGYHFQLSIAAPAGPANYNKLHLGDLGKVLDYINLMAYDFSGSWSNSSAHNANLYAIRANLNAPFNTDHAVNDYIKGGVPASKIVLALPIYGNSFQKTNGIGKPFSGAGDGSWENGIWDYKVHSKAGADGIYDDGDKGYYSYDPSVKELISIDTPDITKDKVTYLKSKGLGGSMFWEASSDRSGSQSLIGTSSNKLGGPDSTENLLNYPDSKYDNMRKQMA

45.9 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make chit1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here