Involved in depolymerization of xylan, a major component of the lignocellulosic substrates. Acts as an endo-xylanase that efficiently hydrolyzes the beta-1,4 glycosidic linkages between the xylopyranosyl residues in the main chain of the polymer, leading to the degradation of xylan into short oligosaccharides. Shows high activity toward branched xylans from both softwoods (arabinoxylans) and hardwoods (glucuronoxylans), showing the highest activity on beechwood xylan. Also hydrolyzes long xylooligosaccharides (with a degree of polymerization of greater than or equal to 5), while oligomers shorter than xylotetraose are not degraded. Is not active on carboxymethyl cellulose (CMC), Avicel, starch, polygalacturonic acid, laminarin, pectin, beta-D-barley glucan, or lichenan.

Belongs to the glycosyl hydrolase 11 (cellulase G) family.

210 amino acids

MFKFGKKLMTVVLAASMSFGVFAATTGATDYWQNWTDGGGTVNAVNGSGGNYSVNWQNTGNFVVGKGWTYGTPNRVVNYNAGVFSPSGNGYLTFYGWTRNALIEYYVVDNWGTYRPTGTYKGTVNSDGGTYDIYTTMRYNQPSIDGYSTFPQYWSVRQSKRPIGVNSQITFQNHVNAWASKGMNLGSSWSYQVLATEGYQSSGSSNVTVW

23.1 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make xyn11E using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here