Endo-1,4-beta-xylanase involved in the hydrolysis of xylan, a major structural heterogeneous polysaccharide found in plant biomass representing the second most abundant polysaccharide in the biosphere, after cellulose. The most favorable substrate is beechwood xylan.

Belongs to the glycosyl hydrolase 11 (cellulase G) family.

250 amino acids

MVSFKSLLLAASAFTAVLGRPFDSFDGPDVNITDADELLVRRQVTANSEGTHNGYFYSWWSDGGGQVTYTMGAGSRYSVTWKDTGNFVGGKGWNPGTGRTINYGGSFSPQGNGYLAVYGWTRNPLIEYYVVESYGTYNPGSGGQLKGTVTTDGGTYNVYVSTRTNQPSIDGTRTFQQYWSVRTSKRVGGAVTMQNHFNAWAQFGMNLGAHYYQIVATEGYQSSGPSDIYVQTQCKSLCDRGRVTWRDVVC

27.4 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make xynG using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here