Hydrolyzes 1,4-beta linked polysaccharide backbones of xylans, one of the major hemicellulose components in hardwoods and softwoods. It is more active against xylopentaose than xylotetraose, has trace activity against xylotriose. The major products released from hydrolysis of xylooligosaccharides are xylobiose and xylotriose. The reiterated 40 AA domain is involved in binding the cellulase-hemicellulase complex.

Belongs to the glycosyl hydrolase 11 (cellulase G) family.

625 amino acids

MKLFQIFPLLLSLTSVTLAADDFCNATGFQGQSVVSTGHDVKKIGNIDYEQWADGGNNSATFYSDGSFKCNFSNTKDYLCRSGVAFSQAKYPSEIGHIEAEYRLVKKSASNVGYSYVGVYGWTLQSGISGVYEYYIVDNWLSQWRPGDWVGNTKFGDFTIDGGVYTVYKNVNGNLTQYFSLRKSERTCGTIDVTAHFAQWEKLGLKMPKITEIKVLAEAGNTGGGCSGSVEIPYAKIYINGKDQDGKSKGGSSSGGSNGQGLGNGQGNGQGQGNGQGQSATGSGKCPSTITSQGYKCCSSNCDIIYRDQSGDWGVENDEWCGCGSRVPKTTNCPSSIKNQGYKCCSDSCEIVLTDSDGDWGIENDEWCGCGIKNTTPTTTTKKSNNSQPTQGQSNNNSSTNTNFCSTSKHSGQSVTETSNKVGSIGGVGYELWADSGNNSATFYSDGSFSCSFRNAKDYLCRSGLSFDSTKTYQQLGHMYADFKLVKQNIQNVDYSYVGIYGWTRNPLVEFYVVDNWLSQWRPGDWVGNKKHGDFTIDGAKYTVYENTRTGPSIDGNTTFKQYFSIRQQARDCGTIDITAHFEQWEKLGMRMGKMHEAKVLGEAGSTGSGTSGTADFPYAKVYIK

68 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make XYNA using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here